SCOPe 2.01: Domain d2wpta_: 2wpt A:

Lineage for d2wpta_ (2wpt A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family)

5. Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)

6. Protein automated matches [190365] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187200] (2 PDB entries)

8. Domain d2wpta_: 2wpt A: [169554]
   Other proteins in same PDB: d2wptb_
   automated match to d1e0ha_
   protein/DNA complex; complexed with gol, no3

Details for d2wpta_

PDB Entry: 2wpt, 1.78 Å

PDB Description: the crystal structure of im2 in complex with colicin e9 dnase

PDB Compounds: (A:) colicin-e2 immunity protein

SCOPe Domain Sequences for d2wpta_:

Sequence; same for both SEQRES and ATOM records:

>d2wpta_ a.28.2.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
khsisdyteaeflefvkkiaraegatecddnklvreferltehpdgsdliyyprddreds
pegivkeikewraangksgfkq

Timeline for d2wpta_:

• d2wpta_ is new in SCOPe 2.01-stable
  
• d2wpta_ appears in SCOPe 2.02
  
• d2wpta_ appears in the current release, SCOPe 2.08