Class a: All alpha proteins [46456] (284 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) |
Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins) |
Protein automated matches [190365] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [187200] (2 PDB entries) |
Domain d2wpta_: 2wpt A: [169554] Other proteins in same PDB: d2wptb_ automated match to d1e0ha_ protein/DNA complex; complexed with gol, no3 |
PDB Entry: 2wpt (more details), 1.78 Å
SCOPe Domain Sequences for d2wpta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wpta_ a.28.2.1 (A:) automated matches {Escherichia coli [TaxId: 562]} khsisdyteaeflefvkkiaraegatecddnklvreferltehpdgsdliyyprddreds pegivkeikewraangksgfkq
Timeline for d2wpta_: