SCOPe 2.03: Domain d2wlvb_: 2wlv B:

Lineage for d2wlvb_ (2wlv B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein automated matches [190369] (6 species)
   not a true protein

7. Species Human immunodeficiency virus type 2 (isolate d194) [TaxId:11713] [189055] (2 PDB entries)

8. Domain d2wlvb_: 2wlv B: [169439]
   automated match to d1m9dc_

Details for d2wlvb_

PDB Entry: 2wlv, 1.25 Å

PDB Description: Structure of the N-terminal capsid domain of HIV-2

PDB Compounds: (B:) gag polyprotein

SCOPe Domain Sequences for d2wlvb_:

Sequence; same for both SEQRES and ATOM records:

>d2wlvb_ a.73.1.1 (B:) automated matches {Human immunodeficiency virus type 2 (isolate d194) [TaxId: 11713]}
pvqhvggtythiplsprtlnawvklvqqkkfgaevvpgfqalsegctpydinqmlncvgd
hqaamqiireiineeaaewdvqhpipgplpagqlreprgsdiagttstveeqiqwmfrpq
npvpvgniyrrwiqiglqkcvrmy

Timeline for d2wlvb_:

• d2wlvb_ first appeared in SCOPe 2.01
  
• d2wlvb_ appears in SCOPe 2.02
  
• d2wlvb_ appears in SCOPe 2.04
  
• d2wlvb_ appears in the current release, SCOPe 2.08