Class a: All alpha proteins [46456] (284 folds) |
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) |
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
Protein automated matches [190369] (6 species) not a true protein |
Species Human immunodeficiency virus type 2 (isolate d194) [TaxId:11713] [189055] (2 PDB entries) |
Domain d2wlva_: 2wlv A: [169438] automated match to d1m9dc_ |
PDB Entry: 2wlv (more details), 1.25 Å
SCOPe Domain Sequences for d2wlva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wlva_ a.73.1.1 (A:) automated matches {Human immunodeficiency virus type 2 (isolate d194) [TaxId: 11713]} pvqhvggtythiplsprtlnawvklveekkfgaevvpgfqalsegctpydinqmlncvgd hqaamqiireiineeaaewdvqhpipgplpagqlreprgsdiagttstveeqiqwmfrpq npvpvgniyrrwiqiglqkcvrmy
Timeline for d2wlva_: