Lineage for d2wlva_ (2wlv A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273716Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1273717Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 1273718Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1273825Protein automated matches [190369] (6 species)
    not a true protein
  7. 1273852Species Human immunodeficiency virus type 2 (isolate d194) [TaxId:11713] [189055] (2 PDB entries)
  8. 1273853Domain d2wlva_: 2wlv A: [169438]
    automated match to d1m9dc_

Details for d2wlva_

PDB Entry: 2wlv (more details), 1.25 Å

PDB Description: Structure of the N-terminal capsid domain of HIV-2
PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d2wlva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wlva_ a.73.1.1 (A:) automated matches {Human immunodeficiency virus type 2 (isolate d194) [TaxId: 11713]}
pvqhvggtythiplsprtlnawvklveekkfgaevvpgfqalsegctpydinqmlncvgd
hqaamqiireiineeaaewdvqhpipgplpagqlreprgsdiagttstveeqiqwmfrpq
npvpvgniyrrwiqiglqkcvrmy

SCOPe Domain Coordinates for d2wlva_:

Click to download the PDB-style file with coordinates for d2wlva_.
(The format of our PDB-style files is described here.)

Timeline for d2wlva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2wlvb_