SCOPe 2.01: Domain d2wksb_: 2wks B:

Lineage for d2wksb_ (2wks B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families)

5. Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)

6. Protein automated matches [190071] (3 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [187015] (6 PDB entries)

8. Domain d2wksb_: 2wks B: [169416]
   automated match to d1j2ya_
   complexed with cb6

Details for d2wksb_

PDB Entry: 2wks, 2.95 Å

PDB Description: structure of helicobacter pylori type ii dehydroquinase with a new carbasugar-thiophene inhibitor.

PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2wksb_:

Sequence; same for both SEQRES and ATOM records:

>d2wksb_ c.23.13.1 (B:) automated matches {Helicobacter pylori [TaxId: 210]}
mkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffqtnfegeiid
kiqesvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytga
acggvimgfgplgynmalmamvnilaemkafqe

Timeline for d2wksb_:

• d2wksb_ is new in SCOPe 2.01-stable
  
• d2wksb_ appears in SCOPe 2.02
  
• d2wksb_ appears in the current release, SCOPe 2.08