SCOPe 2.06: Domain d2whgb_: 2whg B:

Lineage for d2whgb_ (2whg B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (9 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189349] (34 PDB entries)

8. Domain d2whgb_: 2whg B: [169351]
   automated match to d1ko2a_
   complexed with flc, zn

Details for d2whgb_

PDB Entry: 2whg, 1.9 Å

PDB Description: crystal structure of the di-zinc metallo-beta-lactamase vim-4 from pseudomonas aeruginosa

PDB Compounds: (B:) vim-4 metallo-beta-lactamase

SCOPe Domain Sequences for d2whgb_:

Sequence; same for both SEQRES and ATOM records:

>d2whgb_ d.157.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvneipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaeaegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsanvlyggcavhelsrtsagnv
adadlaewptsveriqkhypeaevvipghglpggldllqhtanvvkahkn

Timeline for d2whgb_:

• d2whgb_ first appeared in SCOPe 2.01
  
• d2whgb_ appears in SCOPe 2.05
  
• d2whgb_ appears in SCOPe 2.07
  
• d2whgb_ appears in the current release, SCOPe 2.08