Lineage for d2wg3b_ (2wg3 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1419023Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 1419024Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 1419029Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
    automatically mapped to Pfam PF01085
  6. 1419042Protein automated matches [190324] (2 species)
    not a true protein
  7. 1419043Species Human (Homo sapiens) [TaxId:9606] [188953] (15 PDB entries)
  8. 1419062Domain d2wg3b_: 2wg3 B: [169325]
    automated match to d1vhha_
    complexed with cl, nag, po4, zn

Details for d2wg3b_

PDB Entry: 2wg3 (more details), 2.6 Å

PDB Description: crystal structure of the complex between human hedgehog-interacting protein hip and desert hedgehog without calcium
PDB Compounds: (B:) desert hedgehog protein n-product

SCOPe Domain Sequences for d2wg3b_:

Sequence, based on SEQRES records: (download)

>d2wg3b_ d.65.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alvpllykqfvpgvpertlgasgpaegrvargserfrdlvpnynpdiifkdeensgadrl
mterckervnalaiavmnmwpgvrlrvtegwdedghhaqdslhyegraldittsdrdrnk
ygllarlaveagfdwvyyesrnhvhvsvkadnsl

Sequence, based on observed residues (ATOM records): (download)

>d2wg3b_ d.65.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alvpllykqfvpgvpertlgasgpaegrvargserfrdlvpnynpdiifksgadrlmter
ckervnalaiavmnmwpgvrlrvtegwdedghhaqdslhyegraldittsdrdrnkygll
arlaveagfdwvyyesrnhvhvsvkadnsl

SCOPe Domain Coordinates for d2wg3b_:

Click to download the PDB-style file with coordinates for d2wg3b_.
(The format of our PDB-style files is described here.)

Timeline for d2wg3b_: