SCOPe 2.01: Domain d2wg3a_: 2wg3 A:

Lineage for d2wg3a_ (2wg3 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families)
   zinc-binding motif

5. Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)

6. Protein automated matches [190324] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188953] (11 PDB entries)

8. Domain d2wg3a_: 2wg3 A: [169324]
   automated match to d1vhha_
   complexed with cl, nag, po4, zn

Details for d2wg3a_

PDB Entry: 2wg3, 2.6 Å

PDB Description: crystal structure of the complex between human hedgehog-interacting protein hip and desert hedgehog without calcium

PDB Compounds: (A:) desert hedgehog protein n-product

SCOPe Domain Sequences for d2wg3a_:

Sequence, based on SEQRES records:

>d2wg3a_ d.65.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alvpllykqfvpgvpertlgasgpaegrvargserfrdlvpnynpdiifkdeensgadrl
mterckervnalaiavmnmwpgvrlrvtegwdedghhaqdslhyegraldittsdrdrnk
ygllarlaveagfdwvyyesrnhvhvsvkadnslavlehh

Sequence, based on observed residues (ATOM records):

>d2wg3a_ d.65.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alvpllykqfvpgvpertlgasgpaegrvargserfrdlvpnynpdiifkgadrlmterc
kervnalaiavmnmwpgvrlrvtegwdedghhaqdslhyegraldittsdrdrnkyglla
rlaveagfdwvyyesrnhvhvsvkadnslavlehh

Timeline for d2wg3a_:

• d2wg3a_ is new in SCOPe 2.01-stable
  
• d2wg3a_ appears in SCOPe 2.02
  
• d2wg3a_ appears in the current release, SCOPe 2.08, called d2wg3a1