Lineage for d1acpa_ (1acp A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1086307Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1086308Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1086309Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1086314Protein Acyl carrier protein [47338] (6 species)
  7. 1086320Species Escherichia coli [TaxId:562] [47339] (10 PDB entries)
    Uniprot P02901
  8. 1086341Domain d1acpa_: 1acp A: [16931]

Details for d1acpa_

PDB Entry: 1acp (more details)

PDB Description: refinement of the nmr structures for acyl carrier protein with scalar coupling data
PDB Compounds: (A:) acyl-carrier protein

SCOPe Domain Sequences for d1acpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1acpa_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghqa

SCOPe Domain Coordinates for d1acpa_:

Click to download the PDB-style file with coordinates for d1acpa_.
(The format of our PDB-style files is described here.)

Timeline for d1acpa_: