Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins) the insertion subdomain is a 4-helical bundle |
Protein beta-Phosphoglucomutase [75174] (2 species) |
Species Lactococcus lactis [TaxId:1358] [75175] (13 PDB entries) |
Domain d2wf8a_: 2wf8 A: [169297] automated match to d1lvha_ complexed with bef, bg6, g1p, mg, na, peg |
PDB Entry: 2wf8 (more details), 1.2 Å
SCOPe Domain Sequences for d2wf8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wf8a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd sgalpigvgrpedlgddivivpdtshytleflkevwlq
Timeline for d2wf8a_: