SCOPe 2.05: Domain d2wcfd_: 2wcf D:

Lineage for d2wcfd_ (2wcf D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (35 PDB entries)

8. Domain d2wcfd_: 2wcf D: [169219]
   automated match to d1odba_
   complexed with na

Details for d2wcfd_

PDB Entry: 2wcf, 2.78 Å

PDB Description: calcium-free (apo) s100a12

PDB Compounds: (D:) protein s100-a12

SCOPe Domain Sequences for d2wcfd_:

Sequence, based on SEQRES records:

>d2wcfd_ a.39.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
danqdeqvdfqefislvaialkaahyhthk

Sequence, based on observed residues (ATOM records):

>d2wcfd_ a.39.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tkleehlegivnifhqysvrkfdtlskgelkqlltkelantiknikdkavideifqglda
nqdeqvdfqefislvaialkaahyhthk

Timeline for d2wcfd_:

• d2wcfd_ first appeared in SCOPe 2.01
  
• d2wcfd_ appears in SCOPe 2.04
  
• d2wcfd_ appears in SCOPe 2.06
  
• d2wcfd_ appears in the current release, SCOPe 2.08