Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
Protein automated matches [190132] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187203] (35 PDB entries) |
Domain d2wcfd_: 2wcf D: [169219] automated match to d1odba_ complexed with na |
PDB Entry: 2wcf (more details), 2.78 Å
SCOPe Domain Sequences for d2wcfd_:
Sequence, based on SEQRES records: (download)
>d2wcfd_ a.39.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl danqdeqvdfqefislvaialkaahyhthk
>d2wcfd_ a.39.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tkleehlegivnifhqysvrkfdtlskgelkqlltkelantiknikdkavideifqglda nqdeqvdfqefislvaialkaahyhthk
Timeline for d2wcfd_: