SCOPe 2.02: Domain d2w7ga_: 2w7g A:

Lineage for d2w7ga_ (2w7g A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein Serine hydroxymethyltransferase [53429] (6 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [75272] (39 PDB entries)

8. Domain d2w7ga_: 2w7g A: [169096]
   automated match to d1kkja_
   complexed with alo, mpd, plp, po4

Details for d2w7ga_

PDB Entry: 2w7g, 1.92 Å

PDB Description: crystal structure of y51fbsshmt l-allo-threonine extrnal aldimine

PDB Compounds: (A:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d2w7ga_:

Sequence; same for both SEQRES and ATOM records:

>d2w7ga_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkfaegypgrry
yggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg
ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaasaypriidf
akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthktlrgprggmilcqe
qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg
ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkntipydpespfvtsgirigt
aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltd

Timeline for d2w7ga_:

• d2w7ga_ first appeared in SCOPe 2.01
  
• d2w7ga_ appears in SCOPe 2.03
  
• d2w7ga_ appears in the current release, SCOPe 2.08