SCOPe 2.06: Domain d2w13a_: 2w13 A:

Lineage for d2w13a_ (2w13 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
   Pfam PF01421

6. Protein Snake venom metalloprotease [55520] (7 species)

7. Species Terciopelo (Bothrops asper), bap1 [TaxId:8722] [103127] (5 PDB entries)

8. Domain d2w13a_: 2w13 A: [168997]
   automated match to d1nd1a_
   complexed with act, gol, wr2, zn

Details for d2w13a_

PDB Entry: 2w13, 1.14 Å

PDB Description: high-resolution crystal structure of the p-i snake venom metalloproteinase bap1 in complex with a peptidomimetic: insights into inhibitor binding

PDB Compounds: (A:) zinc metalloproteinase bap1

SCOPe Domain Sequences for d2w13a_:

Sequence; same for both SEQRES and ATOM records:

>d2w13a_ d.92.1.9 (A:) Snake venom metalloprotease {Terciopelo (Bothrops asper), bap1 [TaxId: 8722]}
erfspryielavvadhgiftkynsnlntirtrvhemlntvngfyrsvdvhaplanlevws
kqdlikvqkdssktlksfgewrerdllprishdhaqlltavvfdgntigraytggmcdpr
hsvgvvrdhsknnlwvavtmahelghnlgihhdtgscscgakscimasvlskvlsyefsd
csqnqyetyltnhnpqcilnkp

Timeline for d2w13a_:

• d2w13a_ first appeared in SCOPe 2.01
  
• d2w13a_ appears in SCOPe 2.05
  
• d2w13a_ appears in SCOPe 2.07
  
• d2w13a_ appears in the current release, SCOPe 2.08