Lineage for d2vvia_ (2vvi A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898883Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1898884Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1899479Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1899480Protein automated matches [190526] (20 species)
    not a true protein
  7. 1899649Species Lobophyllia hemprichii [TaxId:46758] [187486] (14 PDB entries)
  8. 1899666Domain d2vvia_: 2vvi A: [168861]
    automated match to d1mova_
    complexed with so3, so4

Details for d2vvia_

PDB Entry: 2vvi (more details), 2 Å

PDB Description: irisfp fluorescent protein in its green form, trans conformation
PDB Compounds: (A:) green to red photoconvertible gpf-like protein eosfp

SCOPe Domain Sequences for d2vvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vvia_ d.22.1.0 (A:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
saikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
hygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfh
gvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykake
kgvklpgyhlvdhcieilshdkdynkvklyehavahsglp

SCOPe Domain Coordinates for d2vvia_:

Click to download the PDB-style file with coordinates for d2vvia_.
(The format of our PDB-style files is described here.)

Timeline for d2vvia_: