![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.0: automated matches [191551] (1 protein) not a true family |
![]() | Protein automated matches [190951] (34 species) not a true protein |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [188718] (2 PDB entries) |
![]() | Domain d2vshb_: 2vsh B: [168787] automated match to d1vpaa_ complexed with 1pe, ca, p6g, peg, pg4 |
PDB Entry: 2vsh (more details), 2 Å
SCOPe Domain Sequences for d2vshb_:
Sequence, based on SEQRES records: (download)
>d2vshb_ c.68.1.0 (B:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} hmiyagilaggtgtrmgisnlpkqflelgdrpilihtiekfvlepsiekivvgvhgdwvs haedlvdkylplykeriiitkggadrntsikniieaidayrpltpedivvthdsvrpfit lrmiqdniqlaqnhdavdtvveavdtivestngqfitdipnrahlyqgqtpqtfrckdfm dlygslsdeekeiltdackifvikgkdvalakgeysnlkittvtdlkiaksmi
>d2vshb_ c.68.1.0 (B:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} hmiyagilagpkqflelgdrpilihtiekfvlepsiekivvgvhgdwvshaedlvdkylp lykeriiitkggadrntsikniieaidayrpltpedivvthdsvrpfitlrmiqdniqla qnhdavdtvveavdtivestngqfitdipnrahlyqgqtpqtfrckdfmdlygslsdeek eiltdackifvikgkdvalakgeysnlkittvtdlkiaksmi
Timeline for d2vshb_: