Lineage for d2vsha_ (2vsh A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1001844Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1001845Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1002508Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 1002509Protein automated matches [190951] (7 species)
    not a true protein
  7. 1002532Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [188718] (2 PDB entries)
  8. 1002533Domain d2vsha_: 2vsh A: [168786]
    automated match to d1vpaa_
    complexed with 1pe, ca, p6g, peg, pg4

Details for d2vsha_

PDB Entry: 2vsh (more details), 2 Å

PDB Description: synthesis of cdp-activated ribitol for teichoic acid precursors in streptococcus pneumoniae
PDB Compounds: (A:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d2vsha_:

Sequence, based on SEQRES records: (download)

>d2vsha_ c.68.1.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
hmiyagilaggtgtrmgisnlpkqflelgdrpilihtiekfvlepsiekivvgvhgdwvs
haedlvdkylplykeriiitkggadrntsikniieaidayrpltpedivvthdsvrpfit
lrmiqdniqlaqnhdavdtvveavdtivestngqfitdipnrahlyqgqtpqtfrckdfm
dlygslsdeekeiltdackifvikgkdvalakgeysnlkittvtdlkiaksmie

Sequence, based on observed residues (ATOM records): (download)

>d2vsha_ c.68.1.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
hmiyagilagpkqflelgdrpilihtiekfvlepsiekivvgvhgdwvshaedlvdkylp
lykeriiitkggadrntsikniieaidayrpltpedivvthdsvrpfitlrmiqdniqla
qnhdavdtvveavdtivestngqfitdipnrahlyqgqtpqtfrckdfmdlygslsdeek
eiltdackifvikgkdvalakgeysnlkittvtdlkiaksmie

SCOPe Domain Coordinates for d2vsha_:

Click to download the PDB-style file with coordinates for d2vsha_.
(The format of our PDB-style files is described here.)

Timeline for d2vsha_: