SCOPe 2.06: Domain d2vokb1: 2vok B:14-192

Lineage for d2vokb1 (2vok B:14-192)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.22: SPRY domain [141154] (6 proteins)
   Pfam PF00622

6. Protein automated matches [190921] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188414] (3 PDB entries)

8. Domain d2vokb1: 2vok B:14-192 [168751]
   Other proteins in same PDB: d2voka2, d2vokb2
   automated match to d2iwgb1

Details for d2vokb1

PDB Entry: 2vok, 1.3 Å

PDB Description: murine trim21

PDB Compounds: (B:) 52 kda ro protein

SCOPe Domain Sequences for d2vokb1:

Sequence; same for both SEQRES and ATOM records:

>d2vokb1 b.29.1.22 (B:14-192) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mvhitldrntanswliiskdrrqvrmgdthqnvsdnkerfsnypmvlgaqrfssgkmywe
vdvtqkeawdlgvcrdsvqrkgqfslspengfwtiwlwqdsyeagtspqttlhiqvppcq
igifvdyeagvvsfynitdhgsliytfsecvfagplrpffnvgfnysggnaaplklcpl

Timeline for d2vokb1:

• d2vokb1 first appeared in SCOPe 2.01, called d2vokb_
  
• d2vokb1 was called d2vokb_ in SCOPe 2.05
  
• d2vokb1 appears in SCOPe 2.07
  
• d2vokb1 appears in the current release, SCOPe 2.08