Lineage for d2vlta_ (2vlt A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879591Species Hordeum vulgare [TaxId:112509] [188423] (3 PDB entries)
  8. 2879596Domain d2vlta_: 2vlt A: [168687]
    automated match to d1xfla_

Details for d2vlta_

PDB Entry: 2vlt (more details), 2 Å

PDB Description: crystal structure of barley thioredoxin h isoform 2 in the oxidized state
PDB Compounds: (A:) thioredoxin h isoform 2.

SCOPe Domain Sequences for d2vlta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vlta_ c.47.1.0 (A:) automated matches {Hordeum vulgare [TaxId: 112509]}
aevisvhsleqwtmqieeantakklvvidftaswcgpcrimapvfadlakkfpnavflkv
dvdelkpiaeqfsveamptflfmkegdvkdrvvgaikeeltakvglhaaaq

SCOPe Domain Coordinates for d2vlta_:

Click to download the PDB-style file with coordinates for d2vlta_.
(The format of our PDB-style files is described here.)

Timeline for d2vlta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2vltb_