SCOPe 2.05: Domain d1buya_: 1buy A:

Lineage for d1buya_ (1buy A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Erythropoietin [47287] (1 species)
   long chain cytokine with a short-chain cytokine topology

7. Species Human (Homo sapiens) [TaxId:9606] [47288] (3 PDB entries)

8. Domain d1buya_: 1buy A: [16848]

Details for d1buya_

PDB Entry: 1buy

PDB Description: human erythropoietin, nmr minimized average structure

PDB Compounds: (A:) protein (erythropoietin)

SCOPe Domain Sequences for d1buya_:

Sequence; same for both SEQRES and ATOM records:

>d1buya_ a.26.1.2 (A:) Erythropoietin {Human (Homo sapiens) [TaxId: 9606]}
apprlicdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqa
vevwqglallseavlrgqallvkssqpweplqlhvdkavsglrslttllralgaqkeais
ppdaasaaplrtitadtfrklfrvysnflrgklklytgeacrtgdr

Timeline for d1buya_:

• d1buya_ first appeared (with stable ids) in SCOP 1.55
  
• d1buya_ appears in SCOPe 2.04
  
• d1buya_ appears in SCOPe 2.06
  
• d1buya_ appears in the current release, SCOPe 2.08