SCOPe 2.07: Domain d2v4zb_: 2v4z B:

Lineage for d2v4zb_ (2v4z B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)

6. Protein automated matches [190756] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187954] (3 PDB entries)

8. Domain d2v4zb_: 2v4z B: [168341]
   automated match to d2jm5a1
   complexed with alf, gdp, mg

Details for d2v4zb_

PDB Entry: 2v4z, 2.8 Å

PDB Description: the crystal structure of the human g-protein subunit alpha (gnai3) in complex with an engineered regulator of g-protein signaling type 2 domain (rgs2)

PDB Compounds: (B:) Regulator of G-protein signaling 2

SCOPe Domain Sequences for d2v4zb_:

Sequence, based on SEQRES records:

>d2v4zb_ a.91.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pspeeaqlwseafdellaskyglaafraflksefseeniefwlacedfkktkspqklssk
arkiytdfiekeapkeinidfqtktliaqniqeatsgcfttaqkrvyslmendsyprflk
sefyqdlc

Sequence, based on observed residues (ATOM records):

>d2v4zb_ a.91.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pspeeaqlwseafdellaskyglaafraflksefseeniefwlacedfkspqklsskark
iytdfiekeapkeinidfqtktliaqnatsgcfttaqkrvyslmendsyprflksefyqd
lc

Timeline for d2v4zb_:

• d2v4zb_ first appeared in SCOPe 2.01
  
• d2v4zb_ appears in SCOPe 2.06
  
• d2v4zb_ appears in the current release, SCOPe 2.08