PDB entry 2v4z
View 2v4z on RCSB PDB site
Description: the crystal structure of the human g-protein subunit alpha (gnai3) in complex with an engineered regulator of g-protein signaling type 2 domain (rgs2)
Class: cell cycle
Keywords: GTP hydrolysis, ADP-ribosylation, nucleotide-binding, lipoprotein, GTP-binding, phosphoprotein, signal transduction inhibitor, guanine nucleotide binding protein, transmembrane signaling, g-protein coupled receptor, palmitate, myristate, transducer, cell cycle
Deposited on
2008-09-30, released
2008-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.21
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Guanine nucleotide-binding protein G(k) subunit alpha
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Regulator of G-protein signaling 2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 2V4Z
- engineered mutation (38)
- engineered mutation (116)
- engineered mutation (123)
- Uniprot P41220
Domains in SCOPe 2.07: d2v4zb_ - Heterogens: GDP, ALF, MG, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2v4zB (B:)
snakpspeeaqlwseafdellaskyglaafraflksefseeniefwlacedfkktkspqk
lsskarkiytdfiekeapkeinidfqtktliaqniqeatsgcfttaqkrvyslmendsyp
rflksefyqdlckkpqitteph
Sequence, based on observed residues (ATOM records): (download)
>2v4zB (B:)
pspeeaqlwseafdellaskyglaafraflksefseeniefwlacedfkspqklsskark
iytdfiekeapkeinidfqtktliaqnatsgcfttaqkrvyslmendsyprflksefyqd
lc