Lineage for d2il6a_ (2il6 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1486907Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1486908Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1486909Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 1486949Protein Interleukin-6 [47272] (2 species)
  7. 1486950Species Human (Homo sapiens) [TaxId:9606] [47273] (7 PDB entries)
  8. 1486959Domain d2il6a_: 2il6 A: [16828]

Details for d2il6a_

PDB Entry: 2il6 (more details)

PDB Description: human interleukin-6, nmr, 32 structures
PDB Compounds: (A:) interleukin-6

SCOPe Domain Sequences for d2il6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2il6a_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
ltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf
neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt
pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

SCOPe Domain Coordinates for d2il6a_:

Click to download the PDB-style file with coordinates for d2il6a_.
(The format of our PDB-style files is described here.)

Timeline for d2il6a_: