Class a: All alpha proteins [46456] (285 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
Protein Interleukin-6 [47272] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47273] (7 PDB entries) |
Domain d2il6a_: 2il6 A: [16828] |
PDB Entry: 2il6 (more details)
SCOPe Domain Sequences for d2il6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2il6a_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]} ltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm
Timeline for d2il6a_: