Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
Protein automated matches [190453] (25 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187367] (4 PDB entries) |
Domain d2v07a_: 2v07 A: [168270] automated match to d1c6sa_ complexed with hem |
PDB Entry: 2v07 (more details), 1.6 Å
SCOPe Domain Sequences for d2v07a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v07a_ a.3.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} diqrgatlfnraciachdtggniiqpgatlftkdlerngvdteeeiyrqtyfgkgrmpgf gekctprgqctfgprlqdeeikllaefvkfqadqgwptv
Timeline for d2v07a_: