Lineage for d2v07a_ (2v07 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2305066Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2305067Protein automated matches [190453] (25 species)
    not a true protein
  7. 2305202Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187367] (4 PDB entries)
  8. 2305209Domain d2v07a_: 2v07 A: [168270]
    automated match to d1c6sa_
    complexed with hem

Details for d2v07a_

PDB Entry: 2v07 (more details), 1.6 Å

PDB Description: structure of the arabidopsis thaliana cytochrome c6a v52q variant
PDB Compounds: (A:) cytochrome c6

SCOPe Domain Sequences for d2v07a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v07a_ a.3.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
diqrgatlfnraciachdtggniiqpgatlftkdlerngvdteeeiyrqtyfgkgrmpgf
gekctprgqctfgprlqdeeikllaefvkfqadqgwptv

SCOPe Domain Coordinates for d2v07a_:

Click to download the PDB-style file with coordinates for d2v07a_.
(The format of our PDB-style files is described here.)

Timeline for d2v07a_: