PDB entry 2v07

View 2v07 on RCSB PDB site
Description: structure of the arabidopsis thaliana cytochrome c6a v52q variant
Class: photosynthesis
Keywords: iron, heme, plastid, thylakoid, transport, chloroplast, metal-binding, photosynthesis, transit peptide, electron transfer, electron transport
Deposited on 2007-05-09, released 2007-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c6
  Species: ARABIDOPSIS THALIANA [TaxId:3702]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q93VA3
    • engineered mutation (17)
    • engineered mutation (51)
  Domains in SCOPe 2.07: d2v07a_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2v07A (A:)
  qtldiqrgatlfnraciachdtggniiqpgatlftkdlerngvdteeeiyrqtyfgkgrm
  pgfgekctprgqctfgprlqdeeikllaefvkfqadqgwptvstd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2v07A (A:)
  diqrgatlfnraciachdtggniiqpgatlftkdlerngvdteeeiyrqtyfgkgrmpgf
  gekctprgqctfgprlqdeeikllaefvkfqadqgwptv