Lineage for d2ri4l_ (2ri4 L:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717797Protein automated matches [190359] (40 species)
    not a true protein
  7. 1717961Species Goat (Capra hircus) [TaxId:9925] [188635] (3 PDB entries)
  8. 1717973Domain d2ri4l_: 2ri4 L: [168136]
    automated match to d1fsxb_
    complexed with hem

Details for d2ri4l_

PDB Entry: 2ri4 (more details), 2.7 Å

PDB Description: crystal structure determination of goat methemoglobin at 2.7 angstrom
PDB Compounds: (L:) Hemoglobin subunit beta-A

SCOPe Domain Sequences for d2ri4l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ri4l_ a.1.1.2 (L:) automated matches {Goat (Capra hircus) [TaxId: 9925]}
mltaeekaavtgfwgkvkvdevgaealgrllvvypwtqrffehfgdlssadavmnnakvk
ahgkkvldsfsngmkhlddlkgtfaqlselhcdklhvdpenfkllgnvlvvvlarhhgse
ftpllqaefqkvvagvanalahryh

SCOPe Domain Coordinates for d2ri4l_:

Click to download the PDB-style file with coordinates for d2ri4l_.
(The format of our PDB-style files is described here.)

Timeline for d2ri4l_: