SCOPe 2.04: Domain d2rd3a_: 2rd3 A:

Lineage for d2rd3a_ (2rd3 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.0: automated matches [191333] (1 protein)
   not a true family

6. Protein automated matches [190172] (8 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [189118] (2 PDB entries)

8. Domain d2rd3a_: 2rd3 A: [168050]
   automated match to d1to9b_

Details for d2rd3a_

PDB Entry: 2rd3, 2.7 Å

PDB Description: crystal structure of tena homologue (hp1287) from helicobacter pylori

PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d2rd3a_:

Sequence; same for both SEQRES and ATOM records:

>d2rd3a_ a.132.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
dpftmqvsqylyqnaqsiwgdcishpfvqgigrgtlerdkfrfyiiqdylflleyakvfa
lgvvkacdeavmrefsnaiqdilnnemsihnhyirelqitqkelqnacptlanksytsym
laegfkgsikevaaavlscgwsylviaqnlsqipnalehafyghwikgysskefqacvnw
ninlldsltlasskqeieklkeifittseyeylfwdmayqs

Timeline for d2rd3a_:

• d2rd3a_ first appeared in SCOPe 2.01
  
• d2rd3a_ appears in SCOPe 2.03
  
• d2rd3a_ appears in SCOPe 2.05
  
• d2rd3a_ appears in the current release, SCOPe 2.08, called d2rd3a1