![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.0: automated matches [191333] (1 protein) not a true family |
![]() | Protein automated matches [190172] (8 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:210] [189118] (2 PDB entries) |
![]() | Domain d2rd3a_: 2rd3 A: [168050] automated match to d1to9b_ |
PDB Entry: 2rd3 (more details), 2.7 Å
SCOPe Domain Sequences for d2rd3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rd3a_ a.132.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]} dpftmqvsqylyqnaqsiwgdcishpfvqgigrgtlerdkfrfyiiqdylflleyakvfa lgvvkacdeavmrefsnaiqdilnnemsihnhyirelqitqkelqnacptlanksytsym laegfkgsikevaaavlscgwsylviaqnlsqipnalehafyghwikgysskefqacvnw ninlldsltlasskqeieklkeifittseyeylfwdmayqs
Timeline for d2rd3a_: