SCOPe 2.01: Domain d2r5xb_: 2r5x B:

Lineage for d2r5xb_ (2r5x B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.11: YugN-like [160755] (2 families)

5. Family d.129.11.0: automated matches [191487] (1 protein)
   not a true family

6. Protein automated matches [190779] (1 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:235909] [188015] (1 PDB entry)

8. Domain d2r5xb_: 2r5x B: [167993]
   automated match to d2pwwa1

Details for d2r5xb_

PDB Entry: 2r5x, 2.04 Å

PDB Description: crystal structure of uncharacterized conserved protein yugn from geobacillus kaustophilus hta426

PDB Compounds: (B:) uncharacterized conserved protein

SCOPe Domain Sequences for d2r5xb_:

Sequence, based on SEQRES records:

>d2r5xb_ d.129.11.0 (B:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
slkfentglenqtvelsrlddimerlgfvraaqwdyervtydrkyvvkegtyylrvqgya
iegnvdsryaliklltpimgkhyyphgveygddehfpsslvsqcqnvlaqvkselekike
e

Sequence, based on observed residues (ATOM records):

>d2r5xb_ d.129.11.0 (B:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
slkfentglenqtvelsrlddimerlgfvraaqwdyervtydrkyvvkegtyylrvqgya
iegnvdsryaliklltpimgkhyyphygddehfpsslvsqcqnvlaqvkselekikee

Timeline for d2r5xb_:

• d2r5xb_ is new in SCOPe 2.01-stable
  
• d2r5xb_ appears in SCOPe 2.02
  
• d2r5xb_ appears in the current release, SCOPe 2.08, called d2r5xb1