Lineage for d2r3zc_ (2r3z C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536142Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2536143Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2536144Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2536468Protein automated matches [190403] (4 species)
    not a true protein
  7. 2536545Species Mouse (Mus musculus) [TaxId:10090] [188560] (2 PDB entries)
  8. 2536548Domain d2r3zc_: 2r3z C: [167968]
    Other proteins in same PDB: d2r3za2, d2r3zb2
    automated match to d1o80a_

Details for d2r3zc_

PDB Entry: 2r3z (more details), 2.5 Å

PDB Description: Crystal structure of mouse IP-10
PDB Compounds: (C:) Small-inducible cytokine B10

SCOPe Domain Sequences for d2r3zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r3zc_ d.9.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
artvrcncihiddgpvrmraigkleiipaslscprveiiatmkkndeqrclnpesktikn
lmkaf

SCOPe Domain Coordinates for d2r3zc_:

Click to download the PDB-style file with coordinates for d2r3zc_.
(The format of our PDB-style files is described here.)

Timeline for d2r3zc_: