Lineage for d1o80a_ (1o80 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536142Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2536143Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2536144Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2536203Protein IP-10/CXCL10 [82573] (1 species)
  7. 2536204Species Human (Homo sapiens) [TaxId:9606] [82574] (4 PDB entries)
  8. 2536205Domain d1o80a_: 1o80 A: [86662]

Details for d1o80a_

PDB Entry: 1o80 (more details), 2 Å

PDB Description: crystal structure of ip-10 h-form
PDB Compounds: (A:) Small inducible cytokine B10

SCOPe Domain Sequences for d1o80a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o80a_ d.9.1.1 (A:) IP-10/CXCL10 {Human (Homo sapiens) [TaxId: 9606]}
vplsrtvrctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeska
iknllkavskemskr

SCOPe Domain Coordinates for d1o80a_:

Click to download the PDB-style file with coordinates for d1o80a_.
(The format of our PDB-style files is described here.)

Timeline for d1o80a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1o80b_