![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.64: Saposin-like [47861] (2 superfamilies) 5 helices; folded leaf, closed |
![]() | Superfamily a.64.1: Saposin [47862] (5 families) ![]() Lipid-binding can promote conformational changes and oligomerisation in some members |
![]() | Family a.64.1.1: NKL-like [47863] (4 proteins) |
![]() | Protein Saposin C [89077] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89078] (11 PDB entries) |
![]() | Domain d2r0ra_: 2r0r A: [167909] Other proteins in same PDB: d2r0rb2 automated match to d2gtga1 complexed with so4 |
PDB Entry: 2r0r (more details), 2.5 Å
SCOPe Domain Sequences for d2r0ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r0ra_ a.64.1.1 (A:) Saposin C {Human (Homo sapiens) [TaxId: 9606]} gfcevceklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvlieil vevmdpsfvclkigacp
Timeline for d2r0ra_: