SCOPe 2.05: Domain d2qtma_: 2qtm A:

Lineage for d2qtma_ (2qtm A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188506] (4 PDB entries)

8. Domain d2qtma_: 2qtm A: [167795]
   automated match to d1kama_
   complexed with co, gol

Details for d2qtma_

PDB Entry: 2qtm, 2.4 Å

PDB Description: crystal structure of nicotinate mononucleotide adenylyltransferase

PDB Compounds: (A:) Nicotinate (Nicotinamide) nucleotide adenylyltransferase

SCOPe Domain Sequences for d2qtma_:

Sequence; same for both SEQRES and ATOM records:

>d2qtma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrditsvesrlqml
elateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwynie
alldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvy
iernglyes

Timeline for d2qtma_:

• d2qtma_ first appeared in SCOPe 2.01
  
• d2qtma_ appears in SCOPe 2.04
  
• d2qtma_ appears in SCOPe 2.06
  
• d2qtma_ appears in the current release, SCOPe 2.08