Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (20 species) not a true protein |
Species Cryptosporidium parvum [TaxId:353152] [188006] (2 PDB entries) |
Domain d2qkra1: 2qkr A:19-310 [167701] Other proteins in same PDB: d2qkra2 automated match to d1ob3a_ complexed with ixm |
PDB Entry: 2qkr (more details), 2.6 Å
SCOPe Domain Sequences for d2qkra1:
Sequence, based on SEQRES records: (download)
>d2qkra1 d.144.1.7 (A:19-310) automated matches {Cryptosporidium parvum [TaxId: 353152]} lmekyqklekvgegtygvvykakdsqgrivalkrirldaedegipstaireisllkelhh pnivslidvihsercltlvfefmekdlkkvldenktglqdsqikiylyqllrgvahchqh rilhrdlkpqnllinsdgalkladfglarafgipvrsythevvtlwyrapdvlmgskkys tsvdiwsigcifaemitgkplfpgvtdddqlpkifsilgtpnprewpqvqelplwkqrtf qvfekkpwssiipgfcqegidllsnmlcfdpnkrisardamnhpyfkdldpq
>d2qkra1 d.144.1.7 (A:19-310) automated matches {Cryptosporidium parvum [TaxId: 353152]} lmekylekvgegvvykakdsqrivalkristaireisllkelhhpnivslidvihseclt lvfefmekdlkkvldenktglqdsqikiylyqllrgvahchqhrilhrdlkpqnllinsd alkladfglarafgipvrvvtlwyrapdvlmgskkystsvdiwsigcifaemitgkplfp gvtdddqlpkifsilgtpnprewpqvqelplwkqrtfqvfekkpwssiipgfcqegidll snmlcfdpnkrisardamnhpyfkdldpq
Timeline for d2qkra1: