SCOPe 2.06: Domain d2qkra1: 2qkr A:19-310

Lineage for d2qkra1 (2qkr A:19-310)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (17 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [188006] (2 PDB entries)

8. Domain d2qkra1: 2qkr A:19-310 [167701]
   Other proteins in same PDB: d2qkra2
   automated match to d1ob3a_
   complexed with ixm

Details for d2qkra1

PDB Entry: 2qkr, 2.6 Å

PDB Description: cryptosporidium parvum cyclin-dependent kinase cgd5_2510 with indirubin 3'-monoxime bound

PDB Compounds: (A:) Cdc2-like CDK2/CDC28 like protein kinase

SCOPe Domain Sequences for d2qkra1:

Sequence, based on SEQRES records:

>d2qkra1 d.144.1.7 (A:19-310) automated matches {Cryptosporidium parvum [TaxId: 353152]}
lmekyqklekvgegtygvvykakdsqgrivalkrirldaedegipstaireisllkelhh
pnivslidvihsercltlvfefmekdlkkvldenktglqdsqikiylyqllrgvahchqh
rilhrdlkpqnllinsdgalkladfglarafgipvrsythevvtlwyrapdvlmgskkys
tsvdiwsigcifaemitgkplfpgvtdddqlpkifsilgtpnprewpqvqelplwkqrtf
qvfekkpwssiipgfcqegidllsnmlcfdpnkrisardamnhpyfkdldpq

Sequence, based on observed residues (ATOM records):

>d2qkra1 d.144.1.7 (A:19-310) automated matches {Cryptosporidium parvum [TaxId: 353152]}
lmekylekvgegvvykakdsqrivalkristaireisllkelhhpnivslidvihseclt
lvfefmekdlkkvldenktglqdsqikiylyqllrgvahchqhrilhrdlkpqnllinsd
alkladfglarafgipvrvvtlwyrapdvlmgskkystsvdiwsigcifaemitgkplfp
gvtdddqlpkifsilgtpnprewpqvqelplwkqrtfqvfekkpwssiipgfcqegidll
snmlcfdpnkrisardamnhpyfkdldpq

Timeline for d2qkra1:

• d2qkra1 first appeared in SCOPe 2.01, called d2qkra_
  
• d2qkra1 was called d2qkra_ in SCOPe 2.05
  
• d2qkra1 appears in SCOPe 2.07
  
• d2qkra1 appears in the current release, SCOPe 2.08