Class b: All beta proteins [48724] (174 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein automated matches [190433] (10 species) not a true protein |
Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (21 PDB entries) |
Domain d2qd6a_: 2qd6 A: [167535] automated match to d1fgcc_ complexed with 065, act, cl, na; mutant |
PDB Entry: 2qd6 (more details), 1.28 Å
SCOPe Domain Sequences for d2qd6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qd6a_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggvggfikvrqyd qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
Timeline for d2qd6a_: