Lineage for d2q2ia_ (2q2i A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 950107Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 951085Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 951086Protein automated matches [190576] (5 species)
    not a true protein
  7. 951087Species Agrobacterium tumefaciens [TaxId:176299] [188408] (1 PDB entry)
  8. 951088Domain d2q2ia_: 2q2i A: [167395]
    automated match to d1gd7a_
    complexed with edo, so4

Details for d2q2ia_

PDB Entry: 2q2i (more details), 1.55 Å

PDB Description: Crystal structure of the protein secretion chaperone CsaA from Agrobacterium tumefaciens.
PDB Compounds: (A:) Secretion chaperone

SCOPe Domain Sequences for d2q2ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q2ia_ b.40.4.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
sgeisyadfekvdirvgtiveavpfpearkpaikvkidfgpeigikkssaqitvhytpes
lvgrqvlgvvnfpprqigpfrsevltlgfadangdivlaaverpvpngekmc

SCOPe Domain Coordinates for d2q2ia_:

Click to download the PDB-style file with coordinates for d2q2ia_.
(The format of our PDB-style files is described here.)

Timeline for d2q2ia_: