Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
Superfamily d.24.1: Pili subunits [54523] (7 families) bacterial filament proteins |
Family d.24.1.1: Pilin [54524] (5 proteins) |
Protein Type IV Pilin Pak [109620] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [54527] (3 PDB entries) |
Domain d2py0a_: 2py0 A: [167330] automated match to d1dzoa_ complexed with epe |
PDB Entry: 2py0 (more details), 1.35 Å
SCOPe Domain Sequences for d2py0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2py0a_ d.24.1.1 (A:) Type IV Pilin Pak {Pseudomonas aeruginosa [TaxId: 287]} egtafarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklg tialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkcksdqdpqfipkgcs
Timeline for d2py0a_: