SCOPe 2.01: Domain d2pwoc_: 2pwo C:

Lineage for d2pwoc_ (2pwo C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (17 PDB entries)

8. Domain d2pwoc_: 2pwo C: [167312]
   automated match to d1afva_
   complexed with cl

Details for d2pwoc_

PDB Entry: 2pwo, 1.45 Å

PDB Description: crystal structure of hiv-1 ca146 a92e psuedo cell

PDB Compounds: (C:) Gag-Pol polyprotein (Pr160Gag-Pol)

SCOPe Domain Sequences for d2pwoc_:

Sequence; same for both SEQRES and ATOM records:

>d2pwoc_ a.73.1.1 (C:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmy

Timeline for d2pwoc_:

• d2pwoc_ is new in SCOPe 2.01-stable
  
• d2pwoc_ appears in SCOPe 2.02
  
• d2pwoc_ appears in the current release, SCOPe 2.08