Lineage for d2pu5a_ (2pu5 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1002544Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1002545Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1003104Family c.69.1.10: Carbon-carbon bond hydrolase [53522] (3 proteins)
    closely related to the Proline iminopeptidase-like family
  6. 1003105Protein 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) [53523] (2 species)
  7. 1003106Species Burkholderia xenovorans [TaxId:36873] [159736] (8 PDB entries)
    Uniprot P47229 4-286
  8. 1003115Domain d2pu5a_: 2pu5 A: [167271]
    automated match to d2puha1
    complexed with mli

Details for d2pu5a_

PDB Entry: 2pu5 (more details), 2.3 Å

PDB Description: crystal structure of a c-c bond hydrolase, bphd, from burkholderia xenovorans lb400
PDB Compounds: (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase

SCOPe Domain Sequences for d2pu5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pu5a_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}
taltesstskfvkinekgfsdfnihyneagngetvimlhgggpgaggwsnyyrnvgpfvd
agyrvilkdspgfnksdavvmdeqrglvnaravkglmdaldidrahlvgnsmggatalnf
aleypdrigklilmgpgglgpsmfapmpmegikllfklyaepsyetlkqmlqvflydqsl
iteellqgrweaiqrqpehlknflisaqkaplstwdvtarlgeikaktfitwgrddrfvp
ldhglkllwniddarlhvfskcghwaqwehadefnrlvidflrha

SCOPe Domain Coordinates for d2pu5a_:

Click to download the PDB-style file with coordinates for d2pu5a_.
(The format of our PDB-style files is described here.)

Timeline for d2pu5a_: