Lineage for d2pija_ (2pij A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732724Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1732725Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1733172Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 1733173Protein automated matches [190907] (8 species)
    not a true protein
  7. 1733253Species Pseudomonas fluorescens [TaxId:220664] [188360] (1 PDB entry)
  8. 1733254Domain d2pija_: 2pij A: [167196]
    automated match to d1copd_
    complexed with bct, dtt, so4

Details for d2pija_

PDB Entry: 2pij (more details), 1.7 Å

PDB Description: structure of the cro protein from prophage pfl 6 in pseudomonas fluorescens pf-5
PDB Compounds: (A:) Prophage Pfl 6 Cro

SCOPe Domain Sequences for d2pija_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pija_ a.35.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
mkkiplskyleehgtqsalaaalgvnqsaisqmvragrsieitlyedgrveaneirpip

SCOPe Domain Coordinates for d2pija_:

Click to download the PDB-style file with coordinates for d2pija_.
(The format of our PDB-style files is described here.)

Timeline for d2pija_: