Lineage for d2ox5z_ (2ox5 Z:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523789Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1524658Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1524659Protein automated matches [190226] (39 species)
    not a true protein
  7. 1524820Species Paracoccus denitrificans [TaxId:266] [187968] (3 PDB entries)
  8. 1524828Domain d2ox5z_: 2ox5 Z: [166891]
    automated match to d1v8ha1
    complexed with act, edo, so4

Details for d2ox5z_

PDB Entry: 2ox5 (more details), 1.98 Å

PDB Description: The SoxYZ complex of Paracoccus pantotrophus
PDB Compounds: (Z:) SoxZ protein

SCOPe Domain Sequences for d2ox5z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ox5z_ b.1.18.0 (Z:) automated matches {Paracoccus denitrificans [TaxId: 266]}
addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiava

SCOPe Domain Coordinates for d2ox5z_:

Click to download the PDB-style file with coordinates for d2ox5z_.
(The format of our PDB-style files is described here.)

Timeline for d2ox5z_: