SCOPe 2.08: Domain d2o9ga1: 2o9g A:1-230

Lineage for d2o9ga1 (2o9g A:1-230)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.19: Aquaporin-like [81339] (1 superfamily)
   core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices

4. Superfamily f.19.1: Aquaporin-like [81338] (2 families)

5. Family f.19.1.1: Aquaporin-like [56895] (5 proteins)
   duplication: consist of two similar structural parts
   automatically mapped to Pfam PF00230

6. Protein Aquaporin Z [103470] (1 species)

7. Species Escherichia coli [TaxId:562] [103471] (6 PDB entries)

8. Domain d2o9ga1: 2o9g A:1-230 [166589]
   Other proteins in same PDB: d2o9ga2
   automated match to d1rc2a_
   complexed with bog, hg; mutant

Details for d2o9ga1

PDB Entry: 2o9g, 1.9 Å

PDB Description: crystal structure of aqpz mutant l170c complexed with mercury.

PDB Compounds: (A:) Aquaporin Z

SCOPe Domain Sequences for d2o9ga1:

Sequence; same for both SEQRES and ATOM records:

>d2o9ga1 f.19.1.1 (A:1-230) Aquaporin Z {Escherichia coli [TaxId: 562]}
mfrklaaesfgtfwlvfggsgsavlaagfpelgigfagvalafgltvltmafavghisgg
hfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfasng
ygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglactlihlisipv
tntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtllekr

Timeline for d2o9ga1:

• d2o9ga1 first appeared in SCOPe 2.01, called d2o9ga_
  
• d2o9ga1 appears in SCOPe 2.07