SCOPe 2.02: Domain d2o4lb_: 2o4l B:

Lineage for d2o4lb_ (2o4l B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (7 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (413 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d2o4lb_: 2o4l B: [166537]
   automated match to d1zp8a1
   complexed with cl, gol, tpv

Details for d2o4lb_

PDB Entry: 2o4l, 1.33 Å

PDB Description: crystal structure of hiv-1 protease (q7k, i50v) in complex with tipranavir

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d2o4lb_:

Sequence; same for both SEQRES and ATOM records:

>d2o4lb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggvggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d2o4lb_:

• d2o4lb_ first appeared in SCOPe 2.01
  
• d2o4lb_ appears in SCOPe 2.03
  
• d2o4lb_ appears in the current release, SCOPe 2.08