Lineage for d2o1da_ (2o1d A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962283Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 962284Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 962285Family b.80.1.1: Pectate lyase-like [51127] (3 proteins)
    this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain
  6. 962321Protein automated matches [190887] (1 species)
    not a true protein
  7. 962322Species Bacillus subtilis [TaxId:1423] [188279] (7 PDB entries)
  8. 962328Domain d2o1da_: 2o1d A: [166489]
    automated match to d1bn8a_
    complexed with ca

Details for d2o1da_

PDB Entry: 2o1d (more details), 2 Å

PDB Description: pectate lyase bound to trisaccharide
PDB Compounds: (A:) pectate lyase

SCOPe Domain Sequences for d2o1da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o1da_ b.80.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
adlghqtlgsndgwgaystgttggskasssnvytvsnrnqlvsalgketnttpkiiyikg
tidmnvddnlkplglndykdpeydldkylkaydpstwgkkepsgtqeeararsqknqkar
vmvdipanttivgsgtnakvvggnfqiksdnviirniefqdaydyfpqwdptdgssgnwn
sqydnitinggthiwidhctfndgsrpdstspkyygrkyqhhdgqtdasnganyitmsyn
yyhdhdkssifgssdsktsddgklkitlhhnryknivqaaprvrfgqvhvynnyyegsts
sssypfsyawgigksskiyaqnnvidvpglsaaktisvfsggtalydsgtllngtqinas
aanglsssvgwtpslhgsidasanvksnvinqagagkln

SCOPe Domain Coordinates for d2o1da_:

Click to download the PDB-style file with coordinates for d2o1da_.
(The format of our PDB-style files is described here.)

Timeline for d2o1da_: