Lineage for d2nzod1 (2nzo D:1-110)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2060461Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2060462Protein automated matches [190576] (33 species)
    not a true protein
  7. 2060477Species Bacillus subtilis [TaxId:1423] [187937] (2 PDB entries)
  8. 2060483Domain d2nzod1: 2nzo D:1-110 [166479]
    Other proteins in same PDB: d2nzoa2, d2nzob2, d2nzod2
    automated match to d1gd7a_
    complexed with gol

Details for d2nzod1

PDB Entry: 2nzo (more details), 2 Å

PDB Description: Crystal structure of a secretion chaperone CsaA from Bacillus subtilis in the space group P 32 2 1
PDB Compounds: (D:) Protein csaA

SCOPe Domain Sequences for d2nzod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nzod1 b.40.4.0 (D:1-110) automated matches {Bacillus subtilis [TaxId: 1423]}
maviddfekldirtgtivkaeefpearvpaiklvidfgteigikqssaqitkrykpegli
nkqviavvnfpprriagfksevlvlggipgqgdvvllqpdqpvpngtkig

SCOPe Domain Coordinates for d2nzod1:

Click to download the PDB-style file with coordinates for d2nzod1.
(The format of our PDB-style files is described here.)

Timeline for d2nzod1: