Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (18 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [187937] (2 PDB entries) |
Domain d2nzhb_: 2nzh B: [166470] automated match to d1gd7a_ complexed with gol |
PDB Entry: 2nzh (more details), 1.9 Å
SCOPe Domain Sequences for d2nzhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nzhb_ b.40.4.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} viddfekldirtgtivkaeefpearvpaiklvidfgteigikqssaqitkrykpeglink qviavvnfpprriagfksevlvlggipgqgdvvllqpdqpvpngtkig
Timeline for d2nzhb_: