Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.4: Link domain [56477] (3 proteins) |
Protein automated matches [190733] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187906] (31 PDB entries) |
Domain d2jcra_: 2jcr A: [166008] automated match to d1uuha_ complexed with gol |
PDB Entry: 2jcr (more details), 2 Å
SCOPe Domain Sequences for d2jcra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jcra_ d.169.1.4 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nqidlnvtcryagvfhvekngrysisrteaadlcqafnstlptmdqmklalskgfetcry gfiegnvviprihpnaicaanhtgvyilvtsntshydtycfnasappeedctsvtdlpns fdgpvtitivnrdgtryskkgeyrthqedid
Timeline for d2jcra_: