Lineage for d2jcqa_ (2jcq A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1226319Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1226320Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1226787Family d.169.1.4: Link domain [56477] (3 proteins)
  6. 1226803Protein automated matches [190733] (1 species)
    not a true protein
  7. 1226804Species Mouse (Mus musculus) [TaxId:10090] [187906] (3 PDB entries)
  8. 1226805Domain d2jcqa_: 2jcq A: [166007]
    automated match to d1uuha_
    complexed with 5ax, gol

Details for d2jcqa_

PDB Entry: 2jcq (more details), 1.25 Å

PDB Description: the hyaluronan binding domain of murine cd44 in a type a complex with an ha 8-mer
PDB Compounds: (A:) CD44 antigen

SCOPe Domain Sequences for d2jcqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jcqa_ d.169.1.4 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qidlnvtcryagvfhvekngrysisrteaadlcqafnstlptmdqmklalskgfetcryg
fiegnvviprihpnaicaanhtgvyilvtsntshydtycfnasappeedctsvtdlpnsf
dgpvtitivnrdgtryskkgeyrthqedid

SCOPe Domain Coordinates for d2jcqa_:

Click to download the PDB-style file with coordinates for d2jcqa_.
(The format of our PDB-style files is described here.)

Timeline for d2jcqa_: