Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein M (medium) subunit [81481] (4 species) |
Species Rhodopseudomonas viridis [TaxId:1079] [81478] (21 PDB entries) |
Domain d2jblm_: 2jbl M: [165990] Other proteins in same PDB: d2jblc_, d2jblh1, d2jblh2, d2jbll_ complexed with bcb, bpb, fe, hem, lda, mq7, ns5, sma, so4 |
PDB Entry: 2jbl (more details), 2.4 Å
SCOPe Domain Sequences for d2jblm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jblm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]} adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg aapdypaylpatpdpaslpgapk
Timeline for d2jblm_:
View in 3D Domains from other chains: (mouse over for more information) d2jblc_, d2jblh1, d2jblh2, d2jbll_ |