SCOPe 2.01: Domain d2jblm_: 2jbl M:

Lineage for d2jblm_ (2jbl M:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81478] (10 PDB entries)

8. Domain d2jblm_: 2jbl M: [165990]
   Other proteins in same PDB: d2jblc_, d2jblh1, d2jblh2, d2jbll_
   complexed with bcb, bpb, fe, hem, lda, mq7, ns5, sma, so4

Details for d2jblm_

PDB Entry: 2jbl, 2.4 Å

PDB Description: photosynthetic reaction center from blastochloris viridis

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d2jblm_:

Sequence; same for both SEQRES and ATOM records:

>d2jblm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d2jblm_:

• d2jblm_ is new in SCOPe 2.01-stable
  
• d2jblm_ appears in SCOPe 2.02
  
• d2jblm_ appears in the current release, SCOPe 2.08