SCOPe 2.01: Domain d2j1gc_: 2j1g C:

Lineage for d2j1gc_ (2j1g C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
   unusual fold

4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families)

5. Family d.171.1.0: automated matches [191465] (1 protein)
   not a true family

6. Protein automated matches [190726] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187887] (18 PDB entries)

8. Domain d2j1gc_: 2j1g C: [165799]
   automated match to d1jc9a_
   complexed with act, ca, p4c, sc2

Details for d2j1gc_

PDB Entry: 2j1g, 1.95 Å

PDB Description: l-ficolin complexed to n-acetyl-cystein

PDB Compounds: (C:) ficolin-2

SCOPe Domain Sequences for d2j1gc_:

Sequence; same for both SEQRES and ATOM records:

>d2j1gc_ d.171.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cltgprtckdlldrghflsgwhtiylpdcrpltvlcdmdtdgggwtvfqrrvdgsvdfyr
dwatykqgfgsrlgefwlgndnihaltaqgtselrtdlvdfednyqfakyrsfkvadeae
kynlvlgafvegsagdsltfhnnqsfstkdqdndlntgncavmfqgawwyknchtsnlng
rylrgthgsfanginwksgkgynysykvsemkvrpa

Timeline for d2j1gc_:

• d2j1gc_ is new in SCOPe 2.01-stable
  
• d2j1gc_ appears in SCOPe 2.02
  
• d2j1gc_ appears in the current release, SCOPe 2.08