Lineage for d2ioyb_ (2ioy B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913163Protein automated matches [190296] (11 species)
    not a true protein
  7. 2913223Species Thermoanaerobacter tengcongensis [TaxId:119072] [187869] (1 PDB entry)
  8. 2913225Domain d2ioyb_: 2ioy B: [165629]
    automated match to d1urpa_
    complexed with rip

Details for d2ioyb_

PDB Entry: 2ioy (more details), 1.9 Å

PDB Description: crystal structure of thermoanaerobacter tengcongensis ribose binding protein
PDB Compounds: (B:) Periplasmic sugar-binding protein

SCOPe Domain Sequences for d2ioyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ioyb_ c.93.1.1 (B:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 119072]}
ktiglvistlnnpffvtlkngaeekakelgykiivedsqndsskelsnvedliqqkvdvl
linpvdsdavvtaikeansknipvitidrsanggdvvchiasdnvkggemaaefiakalk
gkgnvvelegipgasaardrgkgfdeaiakypdikivakqaadfdrskglsvmenilqaq
pkidavfaqndemalgaikaieaanrqgiivvgfdgtedalkaikegkmaatiaqqpalm
gslgvemadkylkgekipnfipaelklitkenvq

SCOPe Domain Coordinates for d2ioyb_:

Click to download the PDB-style file with coordinates for d2ioyb_.
(The format of our PDB-style files is described here.)

Timeline for d2ioyb_: